ELISA Recombinant Salmonella choleraesuis Protein MgtC(mgtC)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Salmonella choleraesuis (strain SC-B67) Uniprot NO.:Q57I71 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEERmLMFPYILNLLAAmLLGALIGAERQWRQRMAGLRTNALVATGAAVFILSSMTTSPD SPGRIAAQIVSGIGFLGAGVIMREGMNVRGLNTAATLWCSAGIGVLCGLGQFKNALAATI IILCANILLREAAQRINQLPVSAEGEKRYILKVTCNKEDESEVRQWLLNIVKEAAICLQG LGSVPAQEQGYKEIRAELVGHADYRKTRELIISRIGDNDNITAIHWSIDSQ Protein Names:Recommended name: Protein MgtC Gene Names:Name:mgtC Ordered Locus Names:SCH_3685 Expression Region:1-231 Sequence Info:fµLl length protein