ELISA Recombinant Rat Transmembrane protein C16orf54 homolog

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q5BK39 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPATPQQPSGHTEGLTEPTSEAAMWVVIPCGPCIPImLGLASLTAFFIITTAVLAERLFR RPQPDPSQRAPTLVWRPGGELWIEPTSSARERSEDWYGSSIPLLMDRAPDPPTPGGTLEG RATAPPAIPTPHPSPSSLVPQTPPEVPAQSTFWRPQTQEESPYATGLVSWVGPEPMAEAG LEVGSPRAWRLRQGSLEPDWSLQPRVTLEQISAFWKREGRTSVGF Protein Names:Recommended name: Transmembrane protein C16orf54 homolog Gene Names: Expression Region:1-225 Sequence Info:fµLl length protein