ELISA Recombinant Staphylococcus epidermidis UPF0316 protein SERP1448(SERP1448)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Staphylococcus epidermidis (strain ATCC 35984 / RP62A) Uniprot NO.:Q5HN24 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSAIAQNPWLMVLAIFIINVCYVTFLTMRTILTLKGYRYVAAVVSFMEVLVYVVGLGLVM SSLDQIQNIFAYALGFSVGIIVGMKIEEKLALGYTVVNVTSSEYELDLPNELRNLGYGVT HYEAFGRDGSRMVMQILTPRKYELKLMDTVKNLDPKAFIIAYEPRNIHGGFWVKGVRKRK LKAYEPEQLEVVVDHEEIVGGSSNEQKV Protein Names:Recommended name: UPF0316 protein SERP1448 Gene Names:Ordered Locus Names:SERP1448 Expression Region:1-208 Sequence Info:fµLl length protein