ELISA Recombinant Xenopus laevis Post-GPI attachment to proteins factor 2(pgap2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q5M9A7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVPISMAPDRGANSLVSLRFTTFAVSTVCLPLFAFLFCIVWSLLFNFSETTETHCHVPNY LPSVSAAIGGETPQRYLWRLCIGLHSAPRFLVAMAYLKYYQGTPCSNPYYPRLCHINFLL NSCEIFFLmLLTYVSSSENHEVHKLGFMSFMFFSLGYMFVTCTLWRMTRKWSGSPEERTS YAWKKRLFGFYLLMFLASIVVYIWHNMYCEPGVYTLFAFLEYLVVLSNMAFHMTAWWDFG NKELMICSPGDKRI Protein Names:Recommended name: Post-GPI attachment to proteins factor 2 Gene Names:Name:pgap2 Expression Region:1-254 Sequence Info:fµLl length protein