ELISA Recombinant Pongo abelii Opalin(OPALIN)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pongo abelii (Sumatran orangutan) Uniprot NO.:Q5R461 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSFSLNFTLPANTTSSPVTGGKETDCGPSLGLAAGIPSLVATALLVALLFTLIHRRRSSI EAMEESDRPCEISEIDDSPKISENPRRSPTHEKNTMGAQEAHIYVKTAAGSEEPVHDRYR PTIEMERRRGLWWLVPRLSLE Protein Names:Recommended name: Opalin Alternative name(s): Oligodendrocytic myelin paranodal and inner loop protein Transmembrane protein 10 Gene Names:Name:OPALIN Synonyms:TMEM10 Expression Region:1-141 Sequence Info:fµLl length protein