Skip to Content

ELISA Recombinant Pongo abelii GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase(ALG11)

https://www.anagnostics.com/web/image/product.template/150010/image_1920?unique=41ec440
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pongo abelii (Sumatran orangutan) Uniprot NO.:Q5R7Z6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAAGERSWCLCKLLRFFYSLFFPGLIVCGTLCVCLVIVLWGIRLLLQRKKKLVSTSKNGK NQMVIAFFHPYCNAGGGGERVLWCALRALQKKYPEAVYVVYTGDVNVNGQQILEGAFRRF NIRLIHPVQFVFLRKRYLVEDSLYPHFTLLGQSLGSIFLGWEALMQCVPDVYIDSMGYAF TLPLFKYIGGCQVGSYVHYPTISTDmLSVVKNQNIGFNNAAFITRNPFLSKVKLIYYYLF AFIYGLVGSCSDVVMVNSSWTLNHILSLWKVGNCTNIVYPPCDVQTFLDIPLHEKKMTPG HLLVSVGQFRPEKNHPLQIRAFAKLLNKKMVESPPSLKLVFIGGCRNKDDELRVNQLRRL SEDLGVQEYVEFKINIPFDELKNYLSEATIGLHTMWNEHFGIGVVECMAAGTIILAHNSG GPKLDIVVPHEGDITGFLAESEEDYAETIAHILSMSAEKRLQIRKSARASVSRFSDQEFE VTFLSSVEKLFK Protein Names:Recommended name: GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase EC= 2.4.1.131 Alternative name(s): Asparagine-linked glycosylation protein 11 homolog Glycolipid 2-alpha-mannosyltransferase Gene Names:Name:ALG11 Expression Region:1-492 Sequence Info:fµLl length protein

1,854.00 € 1854.0 EUR 1,854.00 €

1,854.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.