ELISA Recombinant Pongo abelii Derlin-1(DERL1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pongo abelii (Sumatran orangutan) Uniprot NO.:Q5R9W3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSDIGDWFRSIPAITRYWFAATVAVPLVGKLGLISPAYLFLWPEAFLYRFQIWRPITATF YFPVGPGTGFLYLVNLYFLYHYSTRLETGAFDGRPADYLFmLLFNWICIVITGLAMDMQL LMIPLIMSVLYVWAQLNRDMIVSFWFGTRFKACYLPWVILGFNYIIGGSVINELIGNLVG HLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRH NWGQGFRLGDQ Protein Names:Recommended name: Derlin-1 Alternative name(s): Degradation in endoplasmic reticµLum protein 1 Der1-like protein 1 Gene Names:Name:DERL1 Expression Region:1-251 Sequence Info:fµLl length protein