ELISA Recombinant Pongo abelii Secretory carrier-associated membrane protein 4(SCAMP4)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pongo abelii (Sumatran orangutan) Uniprot NO.:Q5RCY9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSEKENNFPPLPKFIPVKPCFYQNFSDEIPVEHQVLVKRIYRLWMFYCATLGVNLIACLA WWIGGGSGTNFGLAFVWLLLFTPCSYVCWFRPVYKAFRADSSFNFMAFFFIFGAQFVLTV IQAIGFSGWGACGWLSAIGFFQYSPGAAVVmLLPAIMFSVSAAMMAIAIMKVHRIYRGAG GSFQKAQTEWNTGTWRNPPSREAQYNNFSGNSLPEYPTVPSYPGSGQWP Protein Names:Recommended name: Secretory carrier-associated membrane protein 4 Short name= Secretory carrier membrane protein 4 Gene Names:Name:SCAMP4 Expression Region:1-229 Sequence Info:fµLl length protein