ELISA Recombinant Xenopus laevis Tetraspanin-31-A(tspan31-a)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q5XHG6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVCGGFTCSKNALCALNVVYmLVGLLLIGVAAWGKGFGIVSSIHIIGGVIAIGVFLLLIA IIGLIGAVSHHQVmLFIYMVVLILVFIFQFIVSCSCLAMNRSQQEYFLNTTWRRMSNETR LNLEETLECCGFLNTTEARELFNKDVALCSHVCPDPHKCLSCGDKmLNHADEALKILGGV GLFFSFTEILGVWLAFRFRNQKDPRANPSAFL Protein Names:Recommended name: Tetraspanin-31-A Short name= Tspan-31-A Alternative name(s): Sarcoma-amplified sequence homolog A Gene Names:Name:tspan31-a Synonyms:sas-a Expression Region:1-212 Sequence Info:fµLl length protein