ELISA Recombinant Xenopus laevis Sodium-potassium-transporting ATPase subunit beta-1-interacting protein 1(nkain1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q66KY5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGRCSGRCTLVGICCLQLAAALQRQIFDFLGYQWAPILANFLHIMVVILGILGTLHYRSR YLILYSIWLALWVAWNAFIICFYLEVGHFSQHRDLIMNFNTSMHRSWWMENGPGCLVTPV RGPPLSLADHHMVTVTGCLLDYPYIEALSSALQIFLALFGFVYACYVSKVFMDEEDSFDF IGSYDSYGYQAPMKTSHLQLQPLYKPG Protein Names:Recommended name: Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 1 Short name= Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 1 Alternative name(s): Protein FAM77C Gene Names:Name:nkain1 Synonyms:fam77c Expression Region:1-207 Sequence Info:fµLl length protein