ELISA Recombinant Rat Taste receptor type 2 member 109(Tas2r109)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q675B9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEHFLKSIFDISKNVLPIILFIELIIGIIGNGFMALVHCMDWVKRKKMSLVNQILTTLAT SRICLLWFmLLGLLITLLDPDLASARMMIQVASNLWIIANHMSIWLATCLTVFYFLKIAN FSSSLFLYLKWRVEKVISVIFLVSLVLLFLNmLLMNLENDMCIAEYHQINISYSFIYHYR ADCERRVLRLHIIILSVPFVLSLPTFLLLIFSLWTHHKKMQQHVQGRRDASTTAHFKALQ TVIAFLLLYCIFILSmLLQFWKYELMKKPLFILFCHIVYGAFPSFHSYVLILGDMKLRQA SLSVLLWLKCRPNYIETLDL Protein Names:Recommended name: Taste receptor type 2 member 109 Short name= T2R109 Alternative name(s): Taste receptor type 2 member 38 Short name= T2R38 Gene Names:Name:Tas2r109 Synonyms:Tas2r38 Expression Region:1-320 Sequence Info:fµLl length protein