ELISA Recombinant Yarrowia lipolytica Golgi apparatus membrane protein TVP18(TVP18)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica) Uniprot NO.:Q6CC06 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSLVEELKTRNFSIYGQWIGVLCIILCIALGIANIFHASLVIIFSIICIVQGLVVVFVEI PFLLRICPVTERFSNFIRFFNQNWPRAAFYIGMATIQYCSLIFMTTSLLVPAVFLTITSM CYALAALKHQEFTGSSTLGGAGIARQIL Protein Names:Recommended name: Golgi apparatus membrane protein TVP18 Gene Names:Name:TVP18 Ordered Locus Names:YALI0C13816g Expression Region:1-148 Sequence Info:fµLl length protein