ELISA Recombinant Rat Receptor expression-enhancing protein 6(Reep6)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q5XI60 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDGLRQRFERFLEQKNVATDALGALEARTGVEKRYLAAGALTLLGLYLLFGYGASLLCNV IGFVYPAYASVKAIESPNKEDDTVWLTYWVVYALFGLVEFFSDLLLFWFPFYYAGKCAFL LFCMTPGPWNGALLLYHRVIRPLFLKHHVALDSAASQLSGRALDIAAGITRDVLQALARG RTLVTPASASESPAALEPDPKSSQTTLLKHK Protein Names:Recommended name: Receptor expression-enhancing protein 6 Alternative name(s): Polyposis locus protein 1-like 1 Gene Names:Name:Reep6 Synonyms:Dp1l1 Expression Region:1-211 Sequence Info:fµLl length protein