Skip to Content

ELISA Recombinant Rat UDP-glucuronosyltransferase 1-1(Ugt1a1)

https://www.anagnostics.com/web/image/product.template/153234/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q64550 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:GKLLVIPIDGSHWLSmLGVIQQLQQKGHEVVVIAPEASIHIKEGSFYTMRKYPVPFQNEN VTAAFVELGRSVFDQDPFLLRVVKTYNKVKRDSSmLLSGCSHLLHNAEFMASLEQSHFDA LLTDPFLPCGSIVAQYLSLPAVYFLNALPCSLDLEATQCPAPLSYVPKSLSSNTDRMNFL QRVKNMIIALTENFLCRVVYSPYGSLATEILQKEVTVKDLLSPASIWLMRNDFVKDYPRP IMPNMVFIGGINCLQKKALSQEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALG RIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLGHPKARAFITHSGSHGIYEGICNGVP MVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLH KDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVY KSCAYGCRKCFGGKGRVKKSHKSKTH Protein Names:Recommended name: UDP-glucuronosyltransferase 1-1 Short name= UDPGT 1-1 Short name= µgT1*1 Short name= µgT1-01 Short name= µgT1.1 EC= 2.4.1.17 Alternative name(s): B1 UDP-glucuronosyltransferase 1A1 Gene Names:Name:µgt1a1 Synonyms:µgt1 Expression Region:30-535 Sequence Info:fµLl length protein

1,869.00 € 1869.0 EUR 1,869.00 €

1,869.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.