ELISA Recombinant Xenopus laevis ER lumen protein retaining receptor 1-B(kdelr1-b)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q68ES4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNIFRFLGDISHLSAIIILLLKIWKSRSCAGISGKSQLLFAIVFTTRYLDLFTNFISFYN TSMKVVYVASSYATVWMIYSKFKATYDGNHDTFRVEFLIVPTAILSFLVNHDFTPLEILW TFSIYLESVAILPQLFMVSKTGEAETITSHYLFALGIYRTLYLFNWIWRYQFEEFFDLIA IVAGLVQTVLYCDFFYLYITKVLKGKKLSLPA Protein Names:Recommended name: ER lumen protein retaining receptor 1-B Alternative name(s): KDEL endoplasmic reticµLum protein retention receptor 1-B Short name= KDEL receptor 1-B Gene Names:Name:kdelr1-b Expression Region:1-212 Sequence Info:fµLl length protein