ELISA Recombinant Xenopus laevis E3 ubiquitin-protein ligase rnf152-B(rnf152-b)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Xenopus laevis (African clawed frog)
Uniprot NO.:Q68EV7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRASQKDLRCPWCRGVTKL PPGYSVSELPDDPDVVAVIAIPHASENTPVFIKLPSNGCYMWPLPVSKERALLPGDIGCR LLPGNQQKPVTVVTMPMEQQPLHGNIPQDIIEEEHERRGVVKSSTWSGVCTVILVACVLV FLLGIVLHNMSCISKRFTVISCG
Protein Names:Recommended name: E3 ubiquitin-protein ligase rnf152-B EC= 6.3.2.- Alternative name(s): RING finger protein 152-B
Gene Names:Name:rnf152-b
Expression Region:1-203
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.