Skip to Content

ELISA Recombinant Xenopus laevis Solute carrier family 25 member 38(slc25a38)

https://www.anagnostics.com/web/image/product.template/161351/image_1920?unique=871b00d
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q6DE75 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSNALVVAGDSLVPSNRVSQMHPVFKAFVCGSLSGTCSTLLFQPLDLVKTRIQAHQLSAS AAGSRPRmLNLLIKVVRNENILGLWKGVSPSFLRCIPGVGLYFSTLYTLKHHFFSERDPK PLESVmLGAGSRTVAAVCmLPFTVVKTRYESGKYGYNSVYGALKAIYKTEGPRGLFSGLT ATLMRDAPFSGIYLMFYTRAKKLAPHDQIDPLFSPVLNFSCGIVAGILASVATQPADVIK THMQLANEKYHWTGKVALNIYRTQGLTGFFQGGVPRALRRTLMAAMAWTVYEQMMEKMGL KS Protein Names:Recommended name: Solute carrier family 25 member 38 Gene Names:Name:slc25a38 Expression Region:1-302 Sequence Info:fµLl length protein

1,654.00 € 1654.0 EUR 1,654.00 €

1,654.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.