ELISA Recombinant Salmonella paratyphi A sn-glycerol-3-phosphate transport system permease protein ugpE(ugpE)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Salmonella paratyphi A (strain ATCC 9150 / SARB42)
Uniprot NO.:Q5PJL0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MIENRRGLTIFSHTmLILGIAVILFPLYVAFVAATLDDRAVFETPMTLLPGTQLLENIKT IWVNGVGVNSAPFWLMmLNSFIMAFSITVGKITVSmLSAFAIVWFRFPLRNLFFWMIFIT LmLPVEVRIFPTVEVIANLKmLDSYAGLTLPLMASATATFLFRQFFMTLPDELVEAARID GASPMRFFRDIVLPLSKTNLAALFVITFIYGWNQYLWPLLIITDVNLGTAVAGIKGMIAT GEGTTQWNQVMAAmLLTLIPPVVIVLAMQRAFVRGLVDSEK
Protein Names:Recommended name: sn-glycerol-3-phosphate transport system permease protein µgpE
Gene Names:Name:µgpE Ordered Locus Names:SPA3407
Expression Region:1-281
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.