Skip to Content

ELISA Recombinant Xenopus laevis E3 ubiquitin-protein ligase MARCH2(41335)

https://www.anagnostics.com/web/image/product.template/161163/image_1920?unique=871b00d
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q5PQ35 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTTGDCCHLPGSLCDCTDSATFLKSLEESDLGRPQYVTQVTAKDGQLLSTVIKALGTQSD GPICRICHEGGNGERLLSPCDCTGTLGTVHKTCLEKWLSSSNTSYCELCHTEFAVERRPR PVTEWLKDPGPRHEKRTLFCDMVCFLFITPLAAISGWLCLRGAQDHLQFNSRLEAVGLIA LTIALFTIYVLWTLVSFRYHCQLYSEWRRTNQKVLLLIPDSKTATTIHHSFLSSKLLKFA SDETTV Protein Names:Recommended name: E3 ubiquitin-protein ligase MARCH2 EC= 6.3.2.- Alternative name(s): Membrane-associated RING finger protein 2 Membrane-associated RING-CH protein II Short name= MARCH-II Gene Names:Name:march2 Expression Region:1-246 Sequence Info:fµLl length protein

1,595.00 € 1595.0 EUR 1,595.00 €

1,595.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.