ELISA Recombinant Pongo abelii Transmembrane 4 L6 family member 4(TM4SF4)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pongo abelii (Sumatran orangutan) Uniprot NO.:Q5R6Z4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MCTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGGILGSGVLMI FPALVFLGLKNNDCCGCCGNEGCGKRFAMFTSTIFAVVGFLGAGYSFIISAISINKGPKC LMANSTWGYPFHDGDYLNDEALWNKCREPLNVVPWNLTLFSILLVVGGIQMVLCAIQVVN GLLGTLCGDCQCCGCCGGDGPV Protein Names:Recommended name: Transmembrane 4 L6 family member 4 Gene Names:Name:TM4SF4 Expression Region:1-202 Sequence Info:fµLl length protein