ELISA Recombinant Xenopus tropicalis Insulin-induced gene 2 protein(insig2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q5U4Q2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGETDNAPRGPPSFLPHKMNLLLRGLLLFLIGVFLALVLNLLQVQRNVTLFPPDVLSSLF SSAWWVPLCCGTAAAAIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDF ANNTQLSLTLAALSIGLWWTFDRSRSGLGLGIGISFFATVVSQLLVYNGVYEYTAPDFLY VRSWLPCIFFAGGITMGNIGRQLEMYERLALVEKSHRD Protein Names:Recommended name: InsµLin-induced gene 2 protein Short name= INSIG-2 Gene Names:Name:insig2 Expression Region:1-218 Sequence Info:fµLl length protein