ELISA Recombinant Rat Short-wave-sensitive opsin 1(Opn1sw)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q63652 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSGEDEFYLFQNISSVGPWDGPQYHIAPVWAFHLQAAFMGFVFFAGTPLNATVLVATLHY KKLRQPLNYILVNVSLGGFLFCIFSVFTVFIASCHGYFLFGRHVCALEAFLGSVAGLVTG WSLAFLAFERYLVICKPFGNIRFNSKHALTVVLITWTIGIGVSIPPFFGWSRFIPEGLQC SCGPDWYTVGTKYRSEHYTWFLFIFCFIIPLSLICFSYFQLLRTLRAVAAQQQESATTQK AEREVSHMVVVMVGSFCLCYVPYAALAMYMVNNRNHGLYLRLVTIPAFFSKSSCVYNPII YCFMNKQFRACILEMVCRKPMTDESDMSGSQKTEVSTVSSSKVGPH Protein Names:Recommended name: Short-wave-sensitive opsin 1 Short name= S opsin Alternative name(s): Blue cone photoreceptor pigment Blue-sensitive opsin Short name= BOP Short wavelength-sensitive cone opsin Gene Names:Name:Opn1sw Synonyms:Bcp Expression Region:1-346 Sequence Info:fµLl length protein