ELISA Recombinant Xenopus laevis Magnesium transporter protein 1(magt1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q63ZR0 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:QKKKEMVLSDKVGQLMDWASKRPVIRMNGDKFRRFIKSPPRNYSVVVMFTALQAHRQCVV CKQADEEYQILANSWRYSSAFTNRIFFAVVDFDEGSDVFQmLNMNSAPTFINFPPKGKPK KGDTYELQVRGFAAEQLARWVADRTDVNIRVIRPPNYAGPLmLGLLLAVIGGLVYLRRSN LDFLNNKTGWALAALCFVLAMTSGQMWNHIRGPPYAHKNPHTNQVNYIHGSSQAQFVAET HIVLLFNGAVTLGMVLLHEAATSDLDVGKRKIMCIAGITLVVIFFSWLLSVFRSKYHGYP YSFLMT Protein Names:Recommended name: Magnesium transporter protein 1 Short name= MagT1 Gene Names:Name:magt1 Expression Region:24-329 Sequence Info:fµLl length protein