ELISA Recombinant Xenopus laevis Mpv17-like protein(mpv17l)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q68F62 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRILIQFTKRHPWLTNVTIYGSLFASADIVQQKLSKSPTEPIDFKQTAKVGLVGFCFHAN FNFFWLRFIERTFPGSAPLNVIRKVACDQLMAAPITISAFYTGLSLLDGERDVFKNLKEK FWPTYKTGVMCWTVFQTINFSVIPPFVRTAYIGVCAFLWTTFLCYIRNRDINEVTTRLLH AVPNIRGKMAFPQDQDDNKPADK Protein Names:Recommended name: Mpv17-like protein Gene Names:Name:mpv17l Expression Region:1-203 Sequence Info:fµLl length protein