ELISA Recombinant Pongo abelii High affinity copper uptake protein 1(SLC31A1)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pongo abelii (Sumatran orangutan)
Uniprot NO.:Q5RAS6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDHSHHMGMSYMDSNSTMQPSHHHPTTSASHSRGGGDSSMMMMPMTFYFGFKNVELLFSG LVINTAGEMAGAFVAVFLLAMFYEGLKIARESLLRKSQVSIRYNSMPVPGPNGTILMETH KTVGQQmLSFPHLLQTVLHIIQVVISYFLmLIFMTYNGYLCIAVAAGAGTGYFLFSWKKA VVVDITEHCH
Protein Names:Recommended name: High affinity copper uptake protein 1 Alternative name(s): Copper transporter 1 Solute carrier family 31 member 1
Gene Names:Name:SLC31A1
Expression Region:1-190
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.