ELISA Recombinant Pongo abelii Cytochrome b561(CYB561)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pongo abelii (Sumatran orangutan) Uniprot NO.:Q5RCZ2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEGGAAASTPAALPYYVAFSQLLGLTLVAMTGAWLGLYRGGIAWESDLQFNAHPLCMVIG LIFLQGDALLVYRVFRNEAKRTTKVLHGLLHIFALVIALVGLVAVFDYHRKEGYADLYSL HSWCGILVFVLYFVQWLVGFSFFLFPGASFSLRSRYRPQHIFFGATIFLLSVGTALLGLK EALLFKLRDKYSAFEPEGVLANVLGLLLACFGGAVLYILTRADWKRPSQAEEQALSMDFK TLTEGDSPGSQ Protein Names:Recommended name: Cytochrome b561 Alternative name(s): Cytochrome b-561 Gene Names:Name:CYB561 Expression Region:1-251 Sequence Info:fµLl length protein