ELISA Recombinant Pongo abelii Zinc transporter ZIP9(SLC39A9)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Pongo abelii (Sumatran orangutan) Uniprot NO.:Q5RE57 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDDFISISLLSLAmLVGCYVAGIIPLAVNFSEDRLKLVTVLGAGLLCGTALAVIVPEGVH ALYEDILEDPEAARSSNSKITTTLGLVVHAAADGVALGAAASTSQTSVQLIVFVAImLHK APAAFGLVSFLMHAGLERNRIRKHLLVFALAAPVMSMVTYLGLSKSSKEALSEVNATGVA mLFSAGTFLYVATVHVLPEVGGIGHSHKLDATGGRGLSRLEVAALVLGCLIPLILSVGHQ H Protein Names:Recommended name: Zinc transporter ZIP9 Alternative name(s): Solute carrier family 39 member 9 Zrt- and Irt-like protein 9 Short name= ZIP-9 Gene Names:Name:SLC39A9 Synonyms:ZIP9 Expression Region:1-241 Sequence Info:fµLl length protein