ELISA Recombinant Rat Tetraspanin-31(Tspan31)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q5U1V9 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MACGGFACSKNALCALNVVYmLVGLLLIGVAAWGKGLGVVSSIHIIGGVIAVGVFLLLIA VAGLVGAVNHHQVLLFFYMIILGLVFIFQFGISCSCLAINRNTQADVINASWWVLSNSTR HELERSFDCCGLFNLTTVHLHDDASCSALCKTRSSPCQMCGETFLKHSDKALKILGGVGL FFSFTEILGVWLAMRFRNQKDPRANPSAFL Protein Names:Recommended name: Tetraspanin-31 Short name= Tspan-31 Alternative name(s): Sarcoma-amplified sequence homolog Gene Names:Name:Tspan31 Synonyms:Sas Expression Region:1-210 Sequence Info:fµLl length protein