ELISA Recombinant Rat Cytochrome b ascorbate-dependent protein 3(Cybasc3)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q5U2W7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASGWFYMSCMVLGSLGSMCILFTTYWMQYWRGGFAWDGTVLMFNWHPVLMVSGMVVLYG AASLVYRLPASWVGPKLPWKVLHAALHLLAFTVTVVGLTAVFGFHNHSKITHLYSLHSWL GITTVALFACQWFLGFAVFLLPWASQWLRSLLKPVHVFFGACILSLSIASVISGINEKLF FVLKNATRPYSSLPGEAVFANSTGILVVSFGLLVLYILLASSWRRPDPGALTDRQVWLLV SHYRWDKAKKACFAPC Protein Names:Recommended name: Cytochrome b ascorbate-dependent protein 3 EC= 1.-.-.- Gene Names:Name:Cybasc3 Expression Region:1-256 Sequence Info:fµLl length protein