ELISA Recombinant Rat Claudin-3(Cldn3)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q63400 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSMGLEITGTSLAVLGWLCTIVCCALPMWRVSAFIGSSIITAQITWEGLWMNCVVQSTGQ MQCKMYDSLLALPQDLQAARALIVVSILLAAFGLLVALVGAQCTNCVQDETAKAKITIVA GVLFLLAAVLTLVPVSWSANTIIRDFYNPLVPEAQKREMGTGLYVGWAAAALQLLGGALL CCSCPPREKYAPTKILYSAPRSTGPGTGTGTAYDRKDYV Protein Names:Recommended name: Claudin-3 Alternative name(s): Rat ventral prostate.1 protein Short name= RVP1 Gene Names:Name:Cldn3 Expression Region:1-219 Sequence Info:fµLl length protein