ELISA Recombinant Rickettsia typhi Ubiquinol-cytochrome c reductase iron-sulfur subunit(petA)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rickettsia typhi (strain ATCC VR-144 / Wilmington)
Uniprot NO.:Q68XA0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSDTEDNRNKQTTRRDFIVLTASSVAAVGAACAFWPIIDSLNPSTDVLALSSIEVDLSSI AIGQTVTVKWQGKPIFITNRTPDGIASARAVKMSELIDPEKDEVRVKAGHDNWLVTIGIC THLGCVPLSNQGEYNGWFCPCHGSQYDSSGRVRKGPASLNLVVPPYIFISDTKIRIG
Protein Names:Recommended name: Ubiquinol-cytochrome c reductase iron-sµLfur subunit EC= 1.10.2.2 Alternative name(s): Rieske iron-sµLfur protein Short name= RISP
Gene Names:Name:petA Ordered Locus Names:RT0261
Expression Region:1-177
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.