Skip to Content

ELISA Recombinant Yarrowia lipolytica 3-ketodihydrosphingosine reductase TSC10(TSC10)

https://www.anagnostics.com/web/image/product.template/161689/image_1920?unique=7c948e0
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica) Uniprot NO.:Q6CE86 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MIFPISEIPDKVTHSILEGVSALQNMSHTAFWSTVLGFLVVARIAVILATPKRRVLDIKG KKVVISGGSQGAGAALAELCYTKGANVVIVSRTVSKLEAQVQKIVTKHEPVFEGQTIRYI SADLTKEEEAIRVFSEETMPAPPDVIFSCAGAAETGFILDFKASQLARAFSTNYLSALFF VHAGTTRMAKEPISPKNPRYVAIFSSVLAFYPLLGYGQYCASKAAVRSLIDSLRVEALPF NIRVVGVFPGNFQSEGFEEENKSKPEITRQIEGPSQAISAEECAKIVFAQMEKGGQMITT DLIGWILQSIALSSSPRSFSLLQIPLAIFMCIFSPVWNAFVNRDVRKYFHANTEYVTRHQ RGGVGSENPTPQ Protein Names:Recommended name: 3-ketodihydrosphingosine reductase TSC10 EC= 1.1.1.102 Alternative name(s): 3-dehydrosphinganine reductase KDS reductase Gene Names:Name:TSC10 Ordered Locus Names:YALI0B17688g Expression Region:1-372 Sequence Info:fµLl length protein

1,728.00 € 1728.0 EUR 1,728.00 €

1,728.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.