ELISA Recombinant Xenopus tropicalis Tumor suppressor candidate 5 homolog(tusc5)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q6DFT4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAINTDTQYEKALGGSGNPLPADSHETEKLLTNASENKEENGMKKSFSVTMSSEKSMGDL EQNGHNLPYKSVSAGQLESAPLSPSRVSLARASSTATTAQEQGRPTDYLVLAIFSCFCPV WPVNIVALVFSIMSRNSLQQGDLDGARRLGRLARLLSVVSILLGLVIIVLCILSLTIFH Protein Names:Recommended name: Tumor suppressor candidate 5 homolog Gene Names:Name:tusc5 Expression Region:1-179 Sequence Info:fµLl length protein