ELISA Recombinant Rat Tetraspan membrane protein of hair cell stereocilia(Lhfpl5)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q5PPI7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVKLLPAQEAAKIYHTNYVRNSRAVGVMWGTLTICFSVLVMALFIQPYWIGDSVSTPQAG YFGLFSYCVGNVLSSELICKGGPLDFSSIPSRAFKTAMFFVALAMFLIIGSIICFSLFFV CNTATVYKICAWMQLAAATGLMIGCLVYPDGWDSSEVRRMCGEQTGKYTLGHCTIRWAFM LAILSIGDALILSFLAFVLGYRQDKLLPDDYKADGNEEV Protein Names:Recommended name: Tetraspan membrane protein of hair cell stereocilia Alternative name(s): Lipoma HMGIC fusion partner-like 5 protein Gene Names:Name:Lhfpl5 Synonyms:Tmhs Expression Region:1-219 Sequence Info:fµLl length protein