Skip to Content

ELISA Recombinant Pongo abelii Torsin-1A-interacting protein 1(TOR1AIP1)

https://www.anagnostics.com/web/image/product.template/150127/image_1920?unique=41ec440
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pongo abelii (Sumatran orangutan) Uniprot NO.:Q5R7A3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAGEGRRAEAVREGWGVYVTPRAPIREGRGRLAPQNGGSSDAPAYRTSLSRQGRREVRFS DEPPEVYGDFEPLVDKERSPVGKRTRLEEFRSDSAKEEVRESAYYLRSRQRRQPRPQEAE EMKTRRTTRLQQQHSQQPPLQPSPVMTRRGLRDSHSSEEDEPSSPTDLSQTISKKTVRSI QEAPAESEDLVISLRRPPLRYPRSEATSVQQKVNFSEEGETEDDQDSSHSSVTTVKSRSR DSDESGDKTTRSSSQYIESFWQSSQSQNFTAHDKQPSVLSSGYQKTPQEWAPQTARMRTR MQTSSPGKSSIYGSFSDDDSILKSELGNQSPSTSSQQVTGQPQNASFVKRNWWWLLPLIA ALASGSFWFFSTPEVETTAVQEFQNQMNQLKNKYQGQDEKLWKRSQTFLEKHLNSSHPRS QPAILLLTAARDAEEALRCLSEQIADAYSSFHSVRAIRIDGTDKATQDSDTVKLEVDQEL SNGLKNGQNAAVVHRFESFPAGSTLIFYKYCDHENAAFKDVALVLTVLLEEETLGTSLGL KEVEEKVRDFLKVKFTNSNTPNSYNHMDPDKLNGLWSRISHLVLPVQPENALKRGICL Protein Names:Recommended name: Torsin-1A-interacting protein 1 Alternative name(s): Lamina-associated polypeptide 1B Short name= LAP1B Gene Names:Name:TOR1AIP1 Expression Region:1-598 Sequence Info:fµLl length protein

1,966.00 € 1966.0 EUR 1,966.00 €

1,966.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.