ELISA Recombinant Pongo abelii Lysosomal-associated transmembrane protein 5(LAPTM5)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Pongo abelii (Sumatran orangutan)
Uniprot NO.:Q5REZ0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDPRLSAVRQTCCCFNVRIATTALAIYHVIMSVLLFIEHSVEVAHGKASCKLSQMGYLRI ADLISSFLLIAmLFIISLSLLIGVVKNREKYLLPFLSLQVMDYLLCLLTLLGSYIELPAY LKLASRSRASPSKFPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQEDMP HNQFIKMMIIFSIAFITVLIFKVYMFKCVWRCYRFIKCMNSVEEKRNSKmLQKVVLPSYE EALSLPSKTPEGGPAPPPYSEV
Protein Names:Recommended name: Lysosomal-associated transmembrane protein 5 Alternative name(s): Lysosomal-associated mµLtitransmembrane protein 5
Gene Names:Name:LAPTM5
Expression Region:1-262
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.