ELISA Recombinant Rat Probable polyprenol reductase(Srd5a3)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q5RJM1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAGWAGAELSVLNPLRALWLLLAAAFLLALLLQLAPARLLPSCALFQDLIRYGKTKQSGS RRPAVCRAFDVPKRYFSHFYVVSVLWNGSLLWFLSQSLFLGAPFPSWLWALLRTLGVTQF QALGMESKASRIQGKKLALSTFLVLVFLWVHSLRRLFECFYVSVFSNTAIHVVQYCFGLV YYVLVGLTVLSQVPMNDKNVYALGKNLLLQARWFHILGMMMFFWSSAHQYKCHVILSNLR RNKKGVVIHCQHRIPFGDWFEYVSSANYLAELMIYISMAVTFGLHNVTWWLVVTYVFFSQ ALSAFFNHRFYKSTFVSYPKHRKAFLPFLF Protein Names:Recommended name: Probable polyprenol reductase EC= 1.3.1.- Alternative name(s): 3-oxo-5-alpha-steroid 4-dehydrogenase 3 EC= 1.3.99.5 Steroid 5-alpha-reductase 3 Short name= S5AR 3 Short name= SR type 3 Gene Names:Name:Srd5a3 Expression Region:1-330 Sequence Info:fµLl length protein