ELISA Recombinant Rat Lysosomal-associated transmembrane protein 4B(Laptm4b)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q5U1W4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKMVAPWTRFYSHSCCLCCHVRTGTILLGIWYLIINAVVLLILLSALADPDQYHFSGSEL GGEFEFMDDANMCIAIAISLLMILICAMATYGAYKQHAAWIIPFFCYQIFDFALNTLVAI TVLVYPNSIQEYIRQLPPSFPYRDDIMSVNPTCLVLVILLFIGIILTFKGYLISCVWSCY RYINGRNSSDVLVYVTSNDTTVLLPPYDDATAVTGTAKEPPPPYVSA Protein Names:Recommended name: Lysosomal-associated transmembrane protein 4B Gene Names:Name:Laptm4b Expression Region:1-227 Sequence Info:fµLl length protein