ELISA Recombinant Xenopus laevis Mitochondrial import inner membrane translocase subunit Tim21(timm21)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q5XKA2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SCLALLHKGAFAAPTSRSLFCAERPISTGCTSLQVKDKRVSVQSTSDGAPPQNASHKVKE AGRDFTYFIVVLIGIGVTGGLFYVVFEELFSSSSPSKIYGEALEKCRSHPEVIGAFGEPI KGYGETTRRGRRQHVSHMEFVKDGIKCMRLKFYIEGSEPRKQGTVHIEVKENPASGKYEF QYIFVEIDTYPRRTIIIEDNR Protein Names:Recommended name: Mitochondrial import inner membrane translocase subunit Tim21 Alternative name(s): TIM21-like protein, mitochondrial Gene Names:Name:timm21 Synonyms:tim21 Expression Region:32-232 Sequence Info:fµLl length protein