ELISA Recombinant Rat Ileal sodium-bile acid cotransporter(Slc10a2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q62633 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDNSSVCSPNATFCEGDSCLVTESNFNAILSTVMSTVLTILLAMVMFSMGCNVEINKFLG HIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVVVLIMGCCPGGTGSNILAYWID GDMDLSVSMTTCSTLLALGMMPLCLFIYTKMWVDSGTIVIPYDSIGISLVALVIPVSIGM FVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWIIEPKLWIIGTIFPIAGYSL GFFLARLAGQPWYRCRTVALETGMQNTQLCSTIVQLSFSPEDLNLVFTFPLIYTVFQLVF AAIILGMYVTYKKCHGKNDAEFLEKTDNDMDPMPSFQETNKGFQPDEK Protein Names:Recommended name: Ileal sodium/bile acid cotransporter Alternative name(s): Apical sodium-dependent bile acid transporter Short name= ASBT Ileal Na(+)/bile acid cotransporter Ileal sodium-dependent bile acid transporter Short na Gene Names:Name:Slc10a2 Synonyms:Ntcp2 Expression Region:1-348 Sequence Info:fµLl length protein