Skip to Content

ELISA Recombinant Rat Vesicle-trafficking protein SEC22a(Sec22a)

https://www.anagnostics.com/web/image/product.template/153279/image_1920?unique=e16ca1f
(0 review)
Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q642F4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSMILSASVVRVRDGLPLSASTDCEQSAGVQECRKYFKmLSRKLAQFPDRCTLKTGRHNI NFISSLGVSYMmLCTENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRPYCFIEFDNFIQ RTKQRYNNPRSLSTKINLSDMQMEIKLRPPYQIPMCELGSANGVTSAFSVDCKGAGKISS AHQRLEPATLSGIVAFILSLLCGALNLIRGFHAIESLLQSDGEDFSYMIAFFLGTAACLY QCYLLVYYTSWRNVKSFLTFGLICLCNMYLYELRNLWQLFFHVTVGAFVTLQIWLRQAQG KAPDHDV Protein Names:Recommended name: Vesicle-trafficking protein SEC22a Alternative name(s): SEC22 vesicle-trafficking protein homolog A SEC22 vesicle-trafficking protein-like 2 Short name= rSec22a Gene Names:Name:Sec22a Synonyms:Sec22l2 Expression Region:1-307 Sequence Info:fµLl length protein

1,659.00 € 1659.0 EUR 1,659.00 €

1,659.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.