ELISA Recombinant Rat Taste receptor type 2 member 135(Tas2r135)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q67ES2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGPIMSTGETSTAHTVLGCQITDKTVITLFVILVFSCLVAVVGNGFIIIALGMKWLLRRT LSAHNKLLISLAASRFCLQCVVIGKNIYVFLNPSSFPYNPVIQLLNLMWDFLTAATIWFC SLLGFFYCVKIATLTHPVFVWLKYRLPGWVPWmLLSAVGMSSLTSILCFIGNHMIYQNYA RRGHQPWNATGNSLRHSLEKFYFISIKIIMWTVPTVIFSIFMSLLLVSLVRHMKKTLLAL SELRDVWAQAHFKALLPLLSFIILFISCFLTLVLSSASSTPYQEFRYWMWQVVIHLCTVI HPIVILLSNPVLRVVMKRGCC Protein Names:Recommended name: Taste receptor type 2 member 135 Short name= T2R135 Short name= T2R35 Alternative name(s): Taste receptor type 2 member 28 Short name= T2R28 Gene Names:Name:Tas2r135 Synonyms:Tas2r28 Expression Region:1-321 Sequence Info:fµLl length protein