ELISA Recombinant Xenopus laevis Post-GPI attachment to proteins factor 3(pgap3)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Xenopus laevis (African clawed frog)
Uniprot NO.:Q68EV0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:DREPVYRDCVTVCDQNNCTGFRLRDFRAQQPLYMRLTGWTCLDDCRYKCMWYTVSLYLKE GHEVPQFHGKWPFSRFLFFQEPASALASFLNGVASLLmLFRYRSSVPSSCQMYRTCLAFS MVSVNAWFWSTIFHTRDTALTEKMDYFCASSVILHSIYLCCMRTFGLQYPSIANAFGAFL VLLFACHISYLTLGRFDYSYNMAANTSFGIVNLMWWLAWCMWRRFHQPYLWKCVLVVVLL QSLALLELLDFPPVMWILDAHALWHFSTIPLHFLFYSFLRDDSLYLLKVNHDDDIPKLD
Protein Names:Recommended name: Post-GPI attachment to proteins factor 3 Alternative name(s): PER1-like domain-containing protein 1
Gene Names:Name:pgap3 Synonyms:perld1
Expression Region:19-317
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.