ELISA Recombinant Rat Protein orai-3(Orai3)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Rattus norvegicus (Rat) Uniprot NO.:Q6AXR8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKGGEGDTGEQAPLNPEVDSPAGSATYREFVHRGYLDLMGASQHSLRALSWRRLYLSRAK LKASSRTSALLSGFAMVAMVEVQLESDHEYPPGLLVAFSACTTVLVAVHLFALMVSTCLL PHIEAVSNIHNLNSVHQSPHQRLHRYVELAWGFSTALGTFLFLAEVVLVGWVKFVPIGAP MDKPAPVVPMSQVPPVTVSLSLASNLTPSSASVATTQQPPKACPPRQVCGSAHGPGWQAA MASTAIMVPVGLVFMAFALHFYRSLVAHKTDRHKQELEELSRLQGELQAV Protein Names:Recommended name: Protein orai-3 Alternative name(s): Transmembrane protein 142C Gene Names:Name:Orai3 Synonyms:Tmem142c Expression Region:1-290 Sequence Info:fµLl length protein