ELISA Recombinant Xenopus laevis Succinate dehydrogenase [ubiquinone] cytochrome b small subunit A, mitochondrial(sdhd-a)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q6AZR3 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:LLIRPVPCLSQDLHTVQTSQIHTSQNHHAASKAASLHWTSERALSVALLGLLPAAYLYPG AAVDYSLAAALTLHGHWGLGQVVTDYVHGDAKIKLANTSLFALSALTFAGLCYFNYHDVG ICKAVAmLWSL Protein Names:Recommended name: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit A, mitochondrial Short name= CybS-A Alternative name(s): Succinate dehydrogenase complex subunit D-A Succinate-ubiquinone oxidoreductase cytochrome b smal Gene Names:Name:sdhd-a Expression Region:22-152 Sequence Info:fµLl length protein