ELISA Recombinant Yarrowia lipolytica Altered inheritance of mitochondria protein 11(AIM11)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica)
Uniprot NO.:Q6C0R5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKFRFGEGAEGTLNTSVTTAMIDQEKRAADLKRRKNQmLLFGGATLATLASCRLTARGIS SRRYIPKMFQANHMPPQSDMVKEAAMAVVFATTMALSSFSMVVFGVAWSQDVTSLKQFAL KMKTKLGAQQIEDEIRNAPMTPETQDLQDQLAGALKKD
Protein Names:Recommended name: Altered inheritance of mitochondria protein 11
Gene Names:Name:AIM11 Ordered Locus Names:YALI0F22367g
Expression Region:1-158
Sequence Info:fµLl length protein
Our Products !
Check out !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.