Skip to Content

ELISA Recombinant Yarrowia lipolytica 3-ketoacyl-CoA reductase(YALI0A06787g)

https://www.anagnostics.com/web/image/product.template/161688/image_1920?unique=7c948e0
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica) Uniprot NO.:Q6CHP1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVYVNAKNYFCDSIINNTDRVLSALIKYHGLSIIAVFLLAIGLFHVALKVVSYVAVLLDV FVLPPTNYLPYGSQRGAWAVVTGASDGIGKEYARQLGLRGFNVFLISRTESKLRELAQEI AEKSKVETKFLAIDVSTDSPQNYKDIETVLETIPSVSILINNVGLSHSIPTPFLETPPAE LHNIIAINNLATLKITQLIAPKIVESVKEARATKKFQKGLILTMGSFGGLLPTPLLATYS GSKAFLQHWSNALAVELAPEHVDVELVVSYLVTSAMSKVRKTSALIPNPKQFVTATLSSV GRAGGAQEKFATSTPYWSHALLHWWIAQTVGVFSKLVAGFNYKMHVDIRKRALKKQARQA AGGVADPKNTTAAREGYATESLKNETLKH Protein Names:Recommended name: 3-ketoacyl-CoA reductase Short name= 3-ketoreductase Short name= KAR EC= 1.1.1.- Alternative name(s): Microsomal beta-keto-reductase Gene Names:Ordered Locus Names:YALI0A06787g Expression Region:1-389 Sequence Info:fµLl length protein

1,746.00 € 1746.0 EUR 1,746.00 €

1,746.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.