ELISA Recombinant Xenopus tropicalis Coiled-coil domain-containing protein 90B, mitochondrial(ccdc90b)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) Uniprot NO.:Q6DJ87 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ATSAALPAGYDVRQVEITPLEQRKLTFDTHALVRELETHGFDKVQAETIVSALATLTNAS IDTVYRDMVTRAQQEITVQQIMAHLDSIRKDMVILEKSEFATLRAENEKMKIELEHVRQH LLNETNRISADAKLDMNLERSRLTDLFTEQEKKLMEASTEFHKKNATTDSVITEINKKID IDIASLKTLMESHKLDTVRYMAASVFTCLAIALGFYRLWK Protein Names:Recommended name: Coiled-coil domain-containing protein 90B, mitochondrial Gene Names:Name:ccdc90b Expression Region:48-267 Sequence Info:fµLl length protein