ELISA Recombinant Xenopus laevis Mitochondrial inner membrane protease subunit 2(immp2l)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Xenopus laevis (African clawed frog) Uniprot NO.:Q5PQ63 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAQHGRRYVRAFISGFFVAVPVTVTFLDRVACIARVEGVSMQPSLNPDARGESDIVLLNR WRARNYDVQRGDIVSLVSPKNPEQKIIKRVIALEGDIVKTLGHKNRYVKVPRGHVWVEGD HHGHSFDSNAFGPVSLGLLHSHATHILWPPNRWQKLKPFLPVERESVQND Protein Names:Recommended name: Mitochondrial inner membrane protease subunit 2 EC= 3.4.21.- Alternative name(s): IMP2-like protein Gene Names:Name:immp2l Expression Region:1-170 Sequence Info:fµLl length protein