Skip to Content

ELISA Recombinant Pongo abelii Long-chain fatty acid transport protein 4(SLC27A4)

https://www.anagnostics.com/web/image/product.template/150023/image_1920?unique=41ec440
(0 review)
Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Pongo abelii (Sumatran orangutan) Uniprot NO.:Q5RDY4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLLGASLVGVLLFSKLVLKLPWTQVGFSLLFLYLGSGGWRFIRVFIKTIRRDIFGGLVLL KVKAKVRQCLRERRTVPILFASTVRRHPDKTALIFEGTDTLWTFRQLDEYSSSVANFLQA RGLASGDVAAIFMENRNEFVGLWLGMAKLGVEAALINTNLRRDAQLHCLTTSRARALVFG SEMASAICEIHASLDPSLSLFCSGSWEPNAVPTSTEHLDPLLKDAPKHLPICPDKGFTDK LFYIYTSGTTGLPKAAIVVHSRYYRMAALVYYGFRMRPNDIVYDCLPLYHSAGNIVGIGQ CLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRYLLNQPPREAENQHQVRMALG NGLRQSIWTNFSSRFHIPQVAEFYGATECNCSLGNFDSQVGACGFNSRILSFVYPIRLVR VNEDTMELIRGPDGICIPCQPGEPGQLVGRIIQKDPLRRFDGYLNQGANDKKIAKDVFKK GDQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVE VPGTEGRAGMAAVASPTGNCDLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTE LRKEGFDPAIVKDPLFYLDARKGRYVPLDQEAYSRIQAGEEKL Protein Names:Recommended name: Long-chain fatty acid transport protein 4 Short name= FATP-4 Short name= Fatty acid transport protein 4 EC= 6.2.1.- Alternative name(s): Solute carrier family 27 member 4 Gene Names:Name:SLC27A4 Synonyms:FATP4 Expression Region:1-643 Sequence Info:fµLl length protein

2,014.00 € 2014.0 EUR 2,014.00 €

2,014.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our Products !

Check out !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.